Result:
found more than 678 distributions - search limited to the first 2001 files matching your query ( run in 2.662 )


Big5

 view release on metacpan or  search on metacpan

lib/Big5.pm  view on Meta::CPAN

  -O       Ebig5::O   File or directory is owned by this real user
  -p       Ebig5::p   Entry is a named pipe (a "fifo")
  -b       Ebig5::b   Entry is a block-special file (like a mountable disk)
  -c       Ebig5::c   Entry is a character-special file (like an I/O device)
  -u       Ebig5::u   File or directory is setuid
  -g       Ebig5::g   File or directory is setgid
  -k       Ebig5::k   File or directory has the sticky bit set
  --------------------------------------------------------------------------

-w only inspects the read-only file attribute (FILE_ATTRIBUTE_READONLY), which
determines whether the directory can be deleted, not whether it can be written

 view all matches for this distribution


Big5HKSCS

 view release on metacpan or  search on metacpan

lib/Big5HKSCS.pm  view on Meta::CPAN

  -O       Ebig5hkscs::O   File or directory is owned by this real user
  -p       Ebig5hkscs::p   Entry is a named pipe (a "fifo")
  -b       Ebig5hkscs::b   Entry is a block-special file (like a mountable disk)
  -c       Ebig5hkscs::c   Entry is a character-special file (like an I/O device)
  -u       Ebig5hkscs::u   File or directory is setuid
  -g       Ebig5hkscs::g   File or directory is setgid
  -k       Ebig5hkscs::k   File or directory has the sticky bit set
  --------------------------------------------------------------------------

-w only inspects the read-only file attribute (FILE_ATTRIBUTE_READONLY), which
determines whether the directory can be deleted, not whether it can be written

 view all matches for this distribution


BikePower

 view release on metacpan or  search on metacpan

BikePower/HTML.pm  view on Meta::CPAN

	     ['transeff', 'transmission_efficiency'],
	     ['rollfriction', 'rolling_friction'],
	     ['weightcyclist', 'weight_cyclist'],
	     ['weightmachine', 'weight_machine'],
	    ) {
	my($cgidef, $method) = ($_->[0], $_->[1]);
	if (exists $bikepower_def{$cgidef}) {
	    my $eval = '$bp_obj->' . $method . '($bikepower_def{$cgidef})';
	    eval $eval;
	    warn $@ if $@; # XXX
	}
    }

 view all matches for this distribution


Bio-ASN1-EntrezGene

 view release on metacpan or  search on metacpan

examples/parse_entrez_gene_example.pl  view on Meta::CPAN

  }

  # tracking info about how this gene has changed
  if(safeval($seq, '{track-info}->[0]->{current-id}'))
  {
    my (@ids, $newegid, $newllid);
    foreach my $id (@{$seq->{'track-info'}->[0]->{'current-id'}})
    {
      my $tmpid = safeval($id, '{tag}->[0]->{id}');
      push(@ids, "$id->{db}:$tmpid");
      $newegid = $tmpid if($id->{db} =~ /^GeneID$/i);
      $newllid = $tmpid if($id->{db} =~ /^LocusID$/i);
    }
    my $comment = "Gene moved: current IDs are: " . join(' ; ', @ids);
  }

 view all matches for this distribution


Bio-Affymetrix

 view release on metacpan or  search on metacpan

lib/Bio/Affymetrix/CHP.pm  view on Meta::CPAN

    return $self->{"no_qc_units"};
}

# MS COM prog ID

=head2 original_com_progid

  Arg [0]    : 	none
  Example    : 	my $com_id=$chp->original_com_progid()
  Description:	Gets the progid of the original Microsoft COM object that made
				this CHP file
  Returntype :	string
  Exceptions : 	none
  Caller     : 	general

=cut

sub original_com_progid {
    my $self=shift;
    return $self->{"com_progid"};
}

# CEL file name this CHP file originated from

=head2 CEL_file_name

lib/Bio/Affymetrix/CHP.pm  view on Meta::CPAN


    if ($self->{"chip_type"}!=0) {
	croak "This software does not process non-expression arrays";
    }
    
    $self->{"com_progid"}=$self->unpack_length_string($fh);
    
    $self->{"cel_file_name"}=$self->unpack_length_string($fh);

    $self->{"probe_array_type"}=$self->unpack_length_string($fh);

lib/Bio/Affymetrix/CHP.pm  view on Meta::CPAN


    if ($self->{"probe_array_type"} ne $self->{"cdf"}->name()) {
	carp "The CDF object you have supplied does not have the same name as the CDF file used to make this CHP file. Results may be dubious";
    }

    $self->{"com_progid"}=$self->unpack_length_string($fh);

    # Actual data. This is the bit that would need to be added to, if we did SNP etc. arrays
    {
	my %data;
	

 view all matches for this distribution


Bio-BPWrapper

 view release on metacpan or  search on metacpan

test-files/test-bioseq.gb  view on Meta::CPAN

                     VRKGPVFSNVILADEINRAPAKVQSALLEAMGERQVTLGDETHRLPDPFFVLATQNPI
                     EQEGTYNLPESQLDRFLLKVNVHYPSVQDEVRLLKIFSVDGRLENIKVAKVMNAYSLA
                     DIKRTVGRVKVDDKIMLYIVTLISASRERDKKTYPFAKYIEFGASPRASLSLLKCARV
                     NALYEGRIFVLPEDVKAVAYSVLRHRITPSYEAEVEEMSIDDIIRMLLSAVALP"
     gene            complement(178917..179543)
                     /gene="gidB"
                     /locus_tag="BB_0177"
     CDS             complement(178917..179543)
                     /gene="gidB"
                     /locus_tag="BB_0177"
                     /EC_number="2.1.-.-"
                     /note="identified by match to protein family HMM PF02527;
                     match to protein family HMM TIGR00138"
                     /codon_start=1

test-files/test-bioseq.gb  view on Meta::CPAN

                     /translation="MISDIEFALSEHNFQFAYKDLQKINLYIKRILLLNTRFNLISNS
                     NSNFNSILNLHVIDSLLGLSTVKEINPSEVLDVGSGAGFPGIILAIFDSSRKYYLLER
                     SKKKSTFLKMIKLELDLENVKILEYEIEKEKKKYEFITIRAFRNMNEYALILKNLLKG
                     GGLIMAYKGKFDRINLEVNQIKNLFSKIEVKSLNSKLRVDRNLVLLYR"
     gene            complement(179540..181405)
                     /gene="gidA"
                     /locus_tag="BB_0178"
     CDS             complement(179540..181405)
                     /gene="gidA"
                     /locus_tag="BB_0178"
                     /note="identified by match to protein family HMM PF01134;
                     match to protein family HMM TIGR00136"
                     /codon_start=1
                     /transl_table=11

 view all matches for this distribution


Bio-BioStudio

 view release on metacpan or  search on metacpan

bin/BS_CodonJuggler.pl  view on Meta::CPAN


#Do reporting
print "\nReport:\n";
foreach my $gname (sort keys %{$state})
{
  my $gid = $state->{$gname}->[3];
  my @results = @{$state->{$gname}};
  next unless($results[0] || $results[1] || $results[2]);
  print $gname, q{ : };
  if ($results[0])
  {

 view all matches for this distribution


Bio-Chaos

 view release on metacpan or  search on metacpan

bin/cx-enscore2chaos.pl  view on Meta::CPAN

	my $cdsseq = '';
	my $in_cds = 0;
	foreach my $exon (@exons) {
	    my ($min, $max, $strand, $contig_id) = 
	      $exon->getl(qw(contig_start contig_end contig_strand contig_id));
	    my $ctgid = $exon->sget_contig_id."-ct";
	    my ($nb, $ne) = bcmm2ibv($min, $max, $strand);
	    my $contig = $contigh{$contig_id};
	    my $dna = $contig->sget("dna/sequence");
	    my $exonseq = cutseq($dna, $nb, $ne);
	    $mrnaseq .= $exonseq;

bin/cx-enscore2chaos.pl  view on Meta::CPAN

		  cutseq($exonseq, 
			 $tnrelpos,
			 length($exonseq),
			 1);
		$tnfloc->set_nbeg($nb + $tnrelpos * $strand);
		$tnfloc->set_srcfeature_id($ctgid);
		if ($exon->sget_exon_id eq
		    $translation->sget_end_exon_id) {

		    $tnfloc->set_nend($nb + 
				      $translation->sget_seq_end * $strand);

bin/cx-enscore2chaos.pl  view on Meta::CPAN

		  cutseq($exonseq, 
			 0,
			 $tnrelpos,
			 1);
		$tnfloc->set_nend($nb + $tnrelpos * $strand);
		if ($ctgid ne $tnfloc->sget_srcfeature_id) {
		    $tnC->add_featureprop(N(featureprop=>[type=>"problem",
							  value=>"CDS range split across contigs; also on $ctgid"]));
		}
	    }
	    else {
		# continuation of CDS
		$cdsseq .= $exonseq if $in_cds;

bin/cx-enscore2chaos.pl  view on Meta::CPAN

			  type=>'exon',
			  featureloc=>[
				       nbeg=>$nb,
				       nend=>$ne,
				       strand=>$strand,
				       srcfeature_id=>$ctgid,
				      ]
			  ]);
	    push(@exC, $f);
	    push(@F, $f);
	    push(@F, 

 view all matches for this distribution


Bio-Cluster

 view release on metacpan or  search on metacpan

lib/Bio/Cluster/UniGene.pm  view on Meta::CPAN

sub new {
    # standard new call..
    my($caller,@args) = @_;
    my $self = $caller->SUPER::new(@args);

    my ($ugid,$desc,$mems,$size,$species,$dispid,$id,$ns,$auth,$v,$seqfact) =
	$self->_rearrange([qw(UNIGENE_ID
			      DESCRIPTION
			      MEMBERS
			      SIZE
			      SPECIES

lib/Bio/Cluster/UniGene.pm  view on Meta::CPAN

			      SEQFACTORY
			      )], @args);

    $self->{'_alphabet'} = 'dna';

    $self->unigene_id($ugid) if $ugid;
    $self->description($desc) if $desc;
    $self->sequences($mems) if $mems;
    $self->size($size) if defined($size);
    $self->display_id($dispid) if $dispid; # overwrites ugid
    $self->object_id($id) if $id;          # overwrites dispid
    $self->namespace($ns || 'UniGene');
    $self->authority($auth || 'NCBI');
    $self->version($v) if defined($v);
    if( ! defined $seqfact ) {

 view all matches for this distribution


Bio-DB-GFF

 view release on metacpan or  search on metacpan

lib/Bio/DB/GFF.pm  view on Meta::CPAN

  $self->_feature_by_id($id,'feature',$callback);
  return wantarray ? @$features : $features->[0];
}
*fetch_feature_by_id = \&get_feature_by_id;

=head2 get_feature_by_gid

 Title   : get_feature_by_gid
 Usage   : $db->get_feature_by_gid($id)
 Function: fetch segments by feature ID
 Returns : a Bio::DB::GFF::Feature object
 Args    : the feature ID
 Status  : public

lib/Bio/DB/GFF.pm  view on Meta::CPAN

The group ID is often more interesting than the feature ID, since
groups can be complex objects containing subobjects.

=cut

sub get_feature_by_gid {
  my $self = shift;
  my $id   = ref($_[0]) eq 'ARRAY' ? $_[0] : \@_;
  my %groups;         # cache the groups we create to avoid consuming too much unecessary memory
  my $features = [];
  my $callback = sub { push @$features,$self->make_feature(undef,\%groups,@_) };
  $self->_feature_by_id($id,'group',$callback);
  return wantarray ? @$features : $features->[0];
}
*fetch_feature_by_gid = \&get_feature_by_gid;

=head2 delete_fattribute_to_features

 Title   : delete_fattribute_to_features
 Usage   : $db->delete_fattribute_to_features(@ids_or_features)

lib/Bio/DB/GFF.pm  view on Meta::CPAN

  my $next = shift @{$self->{ids}};
  return unless $next;
  my $name = ref($next) eq 'ARRAY' ? Bio::DB::GFF::Featname->new(@$next) : $next;
  my $segment = $self->{type} eq 'name'      ? $self->{db}->segment($name)
                : $self->{type} eq 'feature' ? $self->{db}->fetch_feature_by_id($name)
                : $self->{type} eq 'group'   ? $self->{db}->fetch_feature_by_gid($name)
                : $self->throw("Bio::DB::GFF::ID_Iterator called to fetch an unknown type of identifier");
  $self->throw("id does not exist") unless $segment;
  return $segment;
}

 view all matches for this distribution


Bio-DB-NCBIHelper

 view release on metacpan or  search on metacpan

lib/Bio/DB/EntrezGene.pm  view on Meta::CPAN

 Args    : %qualifiers = a hash of qualifiers (ids, format, etc)

=head2 get_Stream_by_id

  Title   : get_Stream_by_id
  Usage   : $stream = $db->get_Stream_by_id( [$gid1, $gid2] );
  Function: Gets a series of Seq objects using Gene ids
  Returns : A Bio::SeqIO stream object
  Args    : A reference to an array of Gene ids

=head2 request_format

 view all matches for this distribution


Bio-DB-SeqFeature

 view release on metacpan or  search on metacpan

lib/Bio/DB/SeqFeature/Store/DBI/MariaDB.pm  view on Meta::CPAN

  my $attribute = $self->_attribute_table;
  $self->_delete_index($attribute,$id);

  my $sth = $self->_prepare("INSERT INTO $attribute (id,attribute_id,attribute_value) VALUES (?,?,?)");
  for my $tag ($obj->get_all_tags) {
    my $tagid = $self->_attributeid($tag);
    for my $value ($obj->get_tag_values($tag)) {
      $sth->execute($id,$tagid,$value) or $self->throw($sth->errstr);
    }
  }
  $sth->finish;
}

lib/Bio/DB/SeqFeature/Store/DBI/MariaDB.pm  view on Meta::CPAN

  my $self = shift;
  my ($obj,$id) = @_;
  my $fh        = $self->dump_filehandle('attribute');
  my $dbh       = $self->dbh;
  for my $tag ($obj->all_tags) {
    my $tagid = $self->_attributeid($tag);
    for my $value ($obj->each_tag_value($tag)) {
      print $fh join("\t",$id,$tagid,$dbh->quote($value)),"\n";
    }
  }
}

sub coverage_array {

 view all matches for this distribution


Bio-DB-TFBS

 view release on metacpan or  search on metacpan

t/data/taxdump/names.dmp  view on Meta::CPAN

9443	|	Primata	|		|	synonym	|
9443	|	Primates	|		|	scientific name	|
9443	|	primate	|		|	equivalent name	|
9526	|	Catarrhini	|		|	scientific name	|
9604	|	Hominidae	|		|	scientific name	|
9604	|	Pongidae	|		|	synonym	|
27591	|	Gazella granti	|		|	scientific name	|
27591	|	Grant's gazelle	|		|	genbank common name	|
27592	|	Bovinae	|		|	scientific name	|
27596	|	Anoa depressicornis	|		|	synonym	|
27596	|	Bubalis depressicornis	|		|	misspelling	|

 view all matches for this distribution


Bio-DB-Taxonomy-sqlite

 view release on metacpan or  search on metacpan

t/data/names.dmp  view on Meta::CPAN

9443	|	Primata	|		|	synonym	|
9443	|	Primates	|		|	scientific name	|
9443	|	primate	|		|	equivalent name	|
9526	|	Catarrhini	|		|	scientific name	|
9604	|	Hominidae	|		|	scientific name	|
9604	|	Pongidae	|		|	synonym	|
27591	|	Gazella granti	|		|	scientific name	|
27591	|	Grant's gazelle	|		|	genbank common name	|
27592	|	Bovinae	|		|	scientific name	|
27596	|	Anoa depressicornis	|		|	synonym	|
27596	|	Bubalis depressicornis	|		|	misspelling	|

 view all matches for this distribution


Bio-DOOP-DOOP

 view release on metacpan or  search on metacpan

lib/Bio/DOOP/SequenceFeature.pm  view on Meta::CPAN

sub get_tfbsid {
  my $self                 = shift;
  return($self->{TFBSID});
}

=head2 get_cpgid

Returns the cpg primary ID, if the feature type is "cpg".

=cut

sub get_cpgid {
  my $self                 = shift;
  return($self->{CPGID});
}

=head2 get_repeatid

 view all matches for this distribution


Bio-Das-ProServer

 view release on metacpan or  search on metacpan

lib/Bio/Das/ProServer/SourceAdaptor.pm  view on Meta::CPAN


  #########
  # Now add the "residues" to the chain
  #
  for my $group (@{$chain->{'groups'}}) {
    my $gid   = $group->{'id'};
    my $icode = $group->{'icode'} || q();

    #########
    # Residue properties
    #
    $response .= sprintf q(<group type="%s" groupID="%s" name="%s" %s>),
                         $group->{'type'},
                         $gid,
                         $group->{'name'},
                         $icode ? qq(insertCode="$icode") : q();

    #########
    # Add the atoms to the chain

 view all matches for this distribution


Bio-EnsEMBL

 view release on metacpan or  search on metacpan

lib/Bio/EnsEMBL/Map/DBSQL/DitagAdaptor.pm  view on Meta::CPAN

  Caller     : general

=cut

sub fetch_by_dbID {
  my ($self, $tagid) = @_;

  if(!$tagid){
    throw "must be called with the type of a ditag.";
  }
  my $sth = $self->prepare("SELECT d.ditag_id, d.name, d.type, d.tag_count, d.sequence
                            FROM   ditag d
                            WHERE  d.ditag_id = ?");
  $sth->execute($tagid);
  my $result = $self->_fetch($sth);

  return $result->[0];
}

 view all matches for this distribution


Bio-GMOD

 view release on metacpan or  search on metacpan

install_util/cgi_install.PLS  view on Meta::CPAN


if (! (-e $cgi_target) ) {
    mkpath($cgi_target,0,0777) or die "unable to create $cgi_target directory\n";
}

my $cgidir = "cgi-bin";
chdir $cgidir;
foreach (glob('*')) {
  next if /README/;
  next if /Makefile/;
  next if /CVS/;
  next if /^[.\#]/;

 view all matches for this distribution


Bio-Genex

 view release on metacpan or  search on metacpan

data/controlled_vocab/AL_Medium.xml  view on Meta::CPAN

<?xml version="1.0" standalone="yes"?>
<controlled_vocabulary db_table="ArrayLayout" db_column="medium" cv_table="AL_Medium">
  <comment type="definition">Referred to in the Array Layout Spots table and used to describe the medium on which the the probe is deposited	
</comment>
<term name="glass_slide"
        description="user sequence features are spotted on a rigid silicon-based support medium"/>
<term name="nylon_membrane"
        description="user sequence features are spotted on a nylon-coated flexible medium"/>
<term name="nitrocellulose"
        description="user sequence features are spotted on a nitrocellulose medium"/>
<term name="gel_sieve"

 view all matches for this distribution


Bio-Gonzales

 view release on metacpan or  search on metacpan

lib/Bio/Gonzales/Domain/Group.pm  view on Meta::CPAN

  my ( $self, $dest ) = @_;
  my $hits = $self->filter_hits;

  my $gffout = Bio::Gonzales::Feat::IO::GFF3->new( file_or_fh => $dest, mode => '>' );

  my $gidcs = $self->group_idcs;
  while ( my ( $d, $idx ) = each %$gidcs ) {
    $gffout->write_comment(" Group $idx contains domain: $d");
  }

  my $i = 0;
  for my $max (@$hits) {

 view all matches for this distribution


Bio-Homology-InterologWalk

 view release on metacpan or  search on metacpan

lib/Bio/Homology/InterologWalk.pm  view on Meta::CPAN

                    @genes = @{$source_species_gene_adaptor->fetch_all_by_external_name($ID)};
               }

               foreach my $gene (@genes){
                    my $all_homologies;
                    my $gid = $gene->stable_id;
                    my $member = $member_adaptor->fetch_by_source_stable_id("ENSEMBLGENE", $gid);
               
                    if (defined $member){
                         if($destorg eq "All"){ #all destination genomes
                              $all_homologies = $homology_adaptor->fetch_all_by_Member($member);
                         }else{ #one destination genome
                              $all_homologies = $homology_adaptor->fetch_all_by_Member_MethodLinkSpeciesSet($member, $orthologues_mlss);
                         }
                    }else{
                         print "$gid ..no member object defined in Ensembl, skipping..\n";
                         next;
                    }
                    next if (scalar(@$all_homologies) == 0);
                    
                    print $gid, " ", ($gene->external_name || '-'), "\t";
                    $counter = _process_homologies(homology_query_id    =>    $gid, 
                                                   homology_vector       =>   $all_homologies, 
                                                   protein_adaptor       =>   $proteintree_adaptor,
                                                   outfile               =>   $out_data,
                                                   hq_only               =>   $onetoone_only
                                                   );

 view all matches for this distribution


Bio-KBase

 view release on metacpan or  search on metacpan

lib/Bio/KBase/InvocationService/InvocationServiceImpl.pm  view on Meta::CPAN

    my @files;
    my $dh;
    opendir($dh, $dir) or die "Cannot open directory: $!";
    while (my $file = readdir($dh)) {
	next if ($file =~ m/^\./);
	my($dev, $ino, $mode, $nlink, $uid, $gid, $rdev, $size, $atime, $mtime, $ctime, $blksize, $blocks) = stat("$dir/$file");

	my $date= strftime("%b %d %G %H:%M:%S", localtime($mtime));

        if (-f "$dir/$file") {
	    push @files, { name => $file, full_path => "$fpath/$file", mod_date => $date, size => $size};

 view all matches for this distribution


Bio-MCPrimers

 view release on metacpan or  search on metacpan

mcprimers.pl  view on Meta::CPAN


####################################################################

sub sanity_check_arguments {

    (my $dev,my $ino,my $mode,my $nlink,my $uid,my $gid,my $rdev,my $size,
       my $atime,my $mtime,my $ctime,my $blksize,my $blocks)
           = stat(*STDIN);
           
    if ($flag{filter} == 0 and $size > 0) {
        die "\nError - Input is redirected and -filter flag not set\n\n";

 view all matches for this distribution


Bio-MUST-Apps-FortyTwo

 view release on metacpan or  search on metacpan

lib/Bio/MUST/Apps/FortyTwo/Manual.pod  view on Meta::CPAN

    # Genus species_taxonid@protacc
    >Arabidopsis thaliana_3702@AAO44026
    # Genus species_subspecies_taxonid@protacc
    >Arabidopsis lyrata_lyrata_81972@EFH60692
    # Genus species_taxonid@protacc
    >Archaeoglobus fulgidus_2234@WP_048095550
    # Genus species_strain_taxonid@protacc
    >Archaeoglobus fulgidus_DSM4304_224325@AAB90113
    # Genus species_strain_taxonid@protacc
    >archaeon 13_1_20CM_2_54_9_1805008@OLE74253

=head3 Reference organisms (C<ref_orgs>, C<ref_banks>)

 view all matches for this distribution


Bio-MUST-Apps-TwoScalp

 view release on metacpan or  search on metacpan

test/seq_in1.fasta  view on Meta::CPAN

EALEGADMVFVTCGLGGGTGTGAAPVIAEMAKKMGALTVSVVTLPFTMEGIRRAKNAEYG
LKRLAKASDTVIVIPNDKLLEVAPKLPIQMAFKVADEILVQAVKGITELITKPGLVNLDF
NDVRAVMKDGGVAMIGIGESDSEKRALEAAEQALNSPLLDVDISGAKGALISISGADVKL
EEAQQIIEYVTRNVDPKAQVIWGIQLEPELEKTIRVMVIVTGVTSRYITFQEETPEPSEE
EVPPVKIDIPEL
>sp|O29715|FTSZ1_ARCFU Cell division protein FtsZ 1 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=ftsZ1 PE=3 SV=1
MFMKSIVEEALARAEREKKERIEGRGFEDVEDEILQVLHELKTVIKVIGVGGGGCNTITR
MYEEGIEGAELIALNTDVQHLYYTKANRRILIGKRRTRGLGAGSLPQVGEEAARESEDEI
KKLVEGSDMVFVTCGLGGGTGTGAAPVVAEAAQEAGALTIAVVTFPFSAEGAVRRANAEA
GLERLREVADTVIVIPNDRLLEVVPNYPMQLAFKVADEILMRAVKGITELITKPALINLD
FADVRTVMEKGGVAMIGLGEASGEDKAAESVRKALKSPLLDVDVSGAKAALVNVTGGPDM

 view all matches for this distribution


Bio-MUST-Core

 view release on metacpan or  search on metacpan

lib/Bio/MUST/Core/Roles/Listable.pm  view on Meta::CPAN

    # #File c111_78.nbs created on Tuesday 5 May 2009 at 11 hours 40
    # #184 positions remain on the 184 aligned positions
    # #life.col,life.nom
    # #Here is the list of the 78 species used:
    # Aciduliprofundum_boonei_T469___________________________________________________  Aeropyrum_pernix_K1____________________________________________________________
    # Archaeoglobus_fulgidus_DSM_4304________________________________________________  Archaeoglobus_profundus_Av18__DSM_5631_________________________________________
    # ...

    my @ids = $self->all_seq_ids;

    open my $out, '>', $outfile;

 view all matches for this distribution


Bio-MUST-Drivers

 view release on metacpan or  search on metacpan

test/fragmentsseq_profile_out.fasta  view on Meta::CPAN

---EQA-----------------LNS-----PL--------LDV-------DISGAKGAL
ISISG-AD----V----KLEEAQQIIE------------YVTRNVD--------PKAQ--
------VIWGIQ--LEPELE-KTIRVMVIVTGV-T-SRY----------------ITFQE
-ET---PEP------------------SEEEVPPVK----------------ID-I----
-PEL--------------------------
>sp|O29715|FTSZ1_ARCFU Cell division protein FtsZ 1 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=ftsZ1 PE=3 SV=1
MFMKSIVEEALA----RAEREK------------------KERIEG---RGFEDVEDEIL
QVLHELKTVIKVIGVGGGGCNTIT------RM--YE----------EG-------IE---
G---AEL---------------I--ALNT---DVQHLYYTK---ANRRILIGKRRTRGLG
AGSLPQVGEEAARESEDEIKK-----LV------EG-----S---DMVFVTCGLGGGTGT
GAAPVVAE--AAQE---A--GALTI-AVV-TFPFSAEGAVRRANAEAGLERLREV-ADTV

 view all matches for this distribution


Bio-MaxQuant-Evidence-Statistics

 view release on metacpan or  search on metacpan

lib/Bio/MaxQuant/Evidence/Statistics.pm  view on Meta::CPAN

    my $result = {};
    foreach my $experiment(keys %$data){
        if(! exists $opts{experiment} || $experiment =~ /$opts{experiment}/){
            $result->{$experiment} = {};
            my $exptdata = $data->{$experiment};
            foreach my $pgid(keys %$exptdata){
                if(! exists $opts{proteinGroupId} || $pgid =~ /$opts{proteinGroupId}/){
                    my $pgdata = $exptdata->{$pgid};
                    if(! exists $opts{leadingProteins} || $pgdata->{'Leading Proteins'} =~ /$opts{leadingProteins}/){
                        if(! exists $opts{notLeadingProteins} || $pgdata->{'Leading Proteins'} !~ /$opts{notLeadingProteins}/){
                            $result->{$experiment}->{$pgid} = $pgdata;
                        }
                    }
                }
            }
        }

lib/Bio/MaxQuant/Evidence/Statistics.pm  view on Meta::CPAN

    my ($o, %opts) = @_; # can set filter here
    $o->logRatios();
    foreach my $replicate($o->experiments()){
        my $median = $o->replicateMedian(%opts, experiment=>$replicate);
        my $p = $o->filter(experiment=>$replicate);
        foreach my $pgid(keys %{$p->{data}->{$replicate}}){
            foreach my $i(0.. $#{$p->{data}->{$replicate}->{$pgid}->{'Ratio H/L'}}){
                if($p->{data}->{$replicate}->{$pgid}->{'Ratio H/L'}->[$i] =~ /\d/){
                    $p->{data}->{$replicate}->{$pgid}->{'Ratio H/L'}->[$i] -= $median;
                }
            }
        }
    }
    # i guess we should do something better with generating this status:

 view all matches for this distribution


Bio-NEXUS

 view release on metacpan or  search on metacpan

lib/Bio/NEXUS/Util/Exceptions.pm  view on Meta::CPAN

		'trace'       => Bio::NEXUS::Util::StackTrace->new,
		'time'        => CORE::time(),
		'pid'         => $$,
		'uid'         => $<,
		'euid'        => $>,
		'gid'         => $(,
		'egid'        => $),
	};
	return bless $self, $class;
}

sub as_string {

 view all matches for this distribution


( run in 2.662 seconds using v1.01-cache-2.11-cpan-acf6aa7dc9e )