Bio-MUST-Apps-OmpaPa
view release on metacpan or search on metacpan
test/blastp.out view on Meta::CPAN
<?xml version="1.0"?>
<!DOCTYPE BlastOutput PUBLIC "-//NCBI//NCBI BlastOutput/EN" "http://www.ncbi.nlm.nih.gov/dtd/NCBI_BlastOutput.dtd">
<BlastOutput>
<BlastOutput_program>blastp</BlastOutput_program>
<BlastOutput_version>BLASTP 2.6.0+</BlastOutput_version>
<BlastOutput_reference>Stephen F. Altschul, Thomas L. Madden, Alejandro A. Sch&auml;ffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search program...
<BlastOutput_db>database</BlastOutput_db>
<BlastOutput_query-ID>Query_1</BlastOutput_query-ID>
<BlastOutput_query-def>Sulfurimonas_autotrophica_563040@ADN08900</BlastOutput_query-def>
<BlastOutput_query-len>675</BlastOutput_query-len>
<BlastOutput_param>
<Parameters>
<Parameters_matrix>BLOSUM62</Parameters_matrix>
<Parameters_expect>10</Parameters_expect>
<Parameters_gap-open>11</Parameters_gap-open>
<Parameters_gap-extend>1</Parameters_gap-extend>
<Parameters_filter>F</Parameters_filter>
</Parameters>
</BlastOutput_param>
<BlastOutput_iterations>
<Iteration>
<Iteration_iter-num>1</Iteration_iter-num>
<Iteration_query-ID>Query_1</Iteration_query-ID>
<Iteration_query-def>Sulfurimonas_autotrophica_563040@ADN08900</Iteration_query-def>
<Iteration_query-len>675</Iteration_query-len>
<Iteration_hits>
<Hit>
<Hit_num>1</Hit_num>
<Hit_id>Sulfurimonas_autotrophica_563040@ADN08900</Hit_id>
<Hit_def>No definition line</Hit_def>
<Hit_accession>Sulfurimonas_autotrophica_563040@ADN08900</Hit_accession>
<Hit_len>675</Hit_len>
<Hit_hsps>
<Hsp>
<Hsp_num>1</Hsp_num>
<Hsp_bit-score>1355.89</Hsp_bit-score>
<Hsp_score>3508</Hsp_score>
<Hsp_evalue>0</Hsp_evalue>
<Hsp_query-from>1</Hsp_query-from>
<Hsp_query-to>675</Hsp_query-to>
<Hsp_hit-from>1</Hsp_hit-from>
<Hsp_hit-to>675</Hsp_hit-to>
<Hsp_query-frame>0</Hsp_query-frame>
<Hsp_hit-frame>0</Hsp_hit-frame>
<Hsp_identity>675</Hsp_identity>
<Hsp_positive>675</Hsp_positive>
<Hsp_gaps>0</Hsp_gaps>
<Hsp_align-len>675</Hsp_align-len>
<Hsp_qseq>MSDILNHSILPFVEHFQHYAVWVVFFAAFSETLIGLGFLLPGSTFLLLLGVLAGQGYFDITSLLLFAVAGAYLGDITNYHIGKHYGTALLGKTWMPFSNEQLSRAHKFLNTHGAKSVFLARFLPGLKESVPFLAGSVKMKQSKFLFWDFFGTIGWSFEVIGIGYLFSASLVLAQIWLGRTITVLAILIFLLALLYLLKQFVVSNAHSAKIVLLSLCHSFLRNPFVSGIIKAHPK...
<Hsp_hseq>MSDILNHSILPFVEHFQHYAVWVVFFAAFSETLIGLGFLLPGSTFLLLLGVLAGQGYFDITSLLLFAVAGAYLGDITNYHIGKHYGTALLGKTWMPFSNEQLSRAHKFLNTHGAKSVFLARFLPGLKESVPFLAGSVKMKQSKFLFWDFFGTIGWSFEVIGIGYLFSASLVLAQIWLGRTITVLAILIFLLALLYLLKQFVVSNAHSAKIVLLSLCHSFLRNPFVSGIIKAHPK...
<Hsp_midline>MSDILNHSILPFVEHFQHYAVWVVFFAAFSETLIGLGFLLPGSTFLLLLGVLAGQGYFDITSLLLFAVAGAYLGDITNYHIGKHYGTALLGKTWMPFSNEQLSRAHKFLNTHGAKSVFLARFLPGLKESVPFLAGSVKMKQSKFLFWDFFGTIGWSFEVIGIGYLFSASLVLAQIWLGRTITVLAILIFLLALLYLLKQFVVSNAHSAKIVLLSLCHSFLRNPFVSGIIKA...
</Hsp>
</Hit_hsps>
</Hit>
<Hit>
<Hit_num>2</Hit_num>
<Hit_id>Hippea_maritima_760142@AEA33167</Hit_id>
<Hit_def>No definition line</Hit_def>
<Hit_accession>Hippea_maritima_760142@AEA33167</Hit_accession>
<Hit_len>698</Hit_len>
<Hit_hsps>
<Hsp>
<Hsp_num>1</Hsp_num>
<Hsp_bit-score>366.311</Hsp_bit-score>
<Hsp_score>939</Hsp_score>
<Hsp_evalue>1.64684e-119</Hsp_evalue>
<Hsp_query-from>1</Hsp_query-from>
<Hsp_query-to>674</Hsp_query-to>
<Hsp_hit-from>3</Hsp_hit-from>
<Hsp_hit-to>698</Hsp_hit-to>
<Hsp_query-frame>0</Hsp_query-frame>
<Hsp_hit-frame>0</Hsp_hit-frame>
<Hsp_identity>237</Hsp_identity>
<Hsp_positive>368</Hsp_positive>
<Hsp_gaps>48</Hsp_gaps>
<Hsp_align-len>709</Hsp_align-len>
<Hsp_qseq>MSDILNHSILPFVEHFQHYAVWVVFFAAFSETLIGLGFLLPGSTFLLLLGVLAGQGYFDITSLLLFAVAGAYLGDITNYHIGKHYGTALLGKTWMPFSNEQLSRAHKFLNTHGAKSVFLARFLPGLKESVPFLAGSVKMKQSKFLFWDFFGTIGWSFEVIGIGYLFSASLVLAQIWLGRTITVLAILIFLLALLYLLKQFVVSNAHSAKIVLLSLCHSFLRNPFVSGIIKAHPK...
<Hsp_hseq>LTEIFNNYIVPYVVHLGILGYWIAALATLLETILVIGLFIPGSTIVLIFGALSAAGYYNFLYLMAFTVSSAVLGDYINYKLGKKYGKSWIVKEKWFLKKSHLEKGKRFFDSYGARSLSIGRLIPGLKETFPFIAGSMDTKLTKFLFWDVIGAIAWSFEFLSAGYLFGSSINLAKAWLGRITIVIAIIFFIFAVLYAFKFFFVKYGSYILALQKSIWNYLKTNSDILRLIDKYPK...
<Hsp_midline>+++I N+ I+P+V H W+ A ET++ +G +PGST +L+ G L+ GY++ L+ F V+ A LGD NY +GK YG + + K L + +F +++GA+S+ + R +PGLKE+ PF+AGS+ K +KFLFWD G I WSFE + GYLF +S+ LA+ WLGR V+AI+ F+ A+LY K F V + S+ + N + +I ...
</Hsp>
test/blastp.out view on Meta::CPAN
<Hsp_bit-score>26.1794</Hsp_bit-score>
<Hsp_score>56</Hsp_score>
<Hsp_evalue>0.349341</Hsp_evalue>
<Hsp_query-from>353</Hsp_query-from>
<Hsp_query-to>435</Hsp_query-to>
<Hsp_hit-from>110</Hsp_hit-from>
<Hsp_hit-to>193</Hsp_hit-to>
<Hsp_query-frame>0</Hsp_query-frame>
<Hsp_hit-frame>0</Hsp_hit-frame>
<Hsp_identity>21</Hsp_identity>
<Hsp_positive>39</Hsp_positive>
<Hsp_gaps>3</Hsp_gaps>
<Hsp_align-len>85</Hsp_align-len>
<Hsp_qseq>LFQRQRPFN-MTHLMEFSFPSGHTAYSAFFYGFLAYA-LARGTTDRGKKVDLFFLWVLLVTAVGFSRLYIGVHYLSDVLAGALLG</Hsp_qseq>
<Hsp_hseq>LVKRPHPFGALIHTARYSFPSV-SVFSIMILVFLIWHFIVPNFSYLFSRITIRFLLVFWIIVISLIKIYLCAVFPSDILASISLS</Hsp_hseq>
<Hsp_midline>L +R PF + H +SFPS + +S FL + + + ++ + FL V + + ++Y+ + SD+LA L </Hsp_midline>
</Hsp>
</Hit_hsps>
</Hit>
<Hit>
<Hit_num>240</Hit_num>
<Hit_id>Helicobacter_pylori_85963@AAD05898</Hit_id>
<Hit_def>No definition line</Hit_def>
<Hit_accession>Helicobacter_pylori_85963@AAD05898</Hit_accession>
<Hit_len>220</Hit_len>
<Hit_hsps>
<Hsp>
<Hsp_num>1</Hsp_num>
<Hsp_bit-score>21.9422</Hsp_bit-score>
<Hsp_score>45</Hsp_score>
<Hsp_evalue>6.88145</Hsp_evalue>
<Hsp_query-from>261</Hsp_query-from>
<Hsp_query-to>450</Hsp_query-to>
<Hsp_hit-from>23</Hsp_hit-from>
<Hsp_hit-to>219</Hsp_hit-to>
<Hsp_query-frame>0</Hsp_query-frame>
<Hsp_hit-frame>0</Hsp_hit-frame>
<Hsp_identity>55</Hsp_identity>
<Hsp_positive>89</Hsp_positive>
<Hsp_gaps>23</Hsp_gaps>
<Hsp_align-len>205</Hsp_align-len>
<Hsp_qseq>SLVLLGGV-------VEDLLTADPIVAVDKRLATLLLAFRS-PILLWIFLKVTLLGSWQIVLGGVILFSLYLLLDNKKYFLAPFWVTLGGCTFFTTGGKWLFQRQRPFNMTHLMEF-----SFPSGHTAYSAFFYGFLAYALARGTTDRGKKVDLFFLWVLLVTAVGFSRLYIGVHYLSDVLAGALLGF--SWLIIGISLSEWRK</Hsp_qseq>
<Hsp_hseq>TLFLLGGVFSAFFILIAGLVFFDYANSMDNAIFNLMRSNSSNPILDQTLQRIVFLGSSQFVLPLSLLVGVFLSLYRKNLALG-VWFVLSVVIF-----EALLESLKHL-LAHSIQWLSHSANFPSTIALSLALFYGLLILLIPHFIAHQIFQNILSYSLFGLILLIGLALIVLGVSF-SSVLGGVCLGALGACFSIGIYLSVFQK</Hsp_hseq>
<Hsp_midline>+L LLGGV + L+ D ++D + L+ + S PIL ++ LGS Q VL +L ++L L K L W L F + L + + + H +++ +FPS A FYG L + + + L + L+ +G + + +GV + S VL G LG + IGI LS ++K</Hsp_midline>
</Hsp>
</Hit_hsps>
</Hit>
</Iteration_hits>
<Iteration_stat>
<Statistics>
<Statistics_db-num>242</Statistics_db-num>
<Statistics_db-len>58121</Statistics_db-len>
<Statistics_hsp-len>68</Statistics_hsp-len>
<Statistics_eff-space>26498940</Statistics_eff-space>
<Statistics_kappa>0.041</Statistics_kappa>
<Statistics_lambda>0.267</Statistics_lambda>
<Statistics_entropy>0.14</Statistics_entropy>
</Statistics>
</Iteration_stat>
</Iteration>
</BlastOutput_iterations>
</BlastOutput>
( run in 1.367 second using v1.01-cache-2.11-cpan-4ab04211f4c )