iterations results from the CPAN

iterations

Bio-MUST-Apps-OmpaPa

view release on metacpan or search on metacpan

<?xml version="1.0"?>
<!DOCTYPE BlastOutput PUBLIC "-//NCBI//NCBI BlastOutput/EN" "http://www.ncbi.nlm.nih.gov/dtd/NCBI_BlastOutput.dtd">
<BlastOutput>
  <BlastOutput_program>blastp</BlastOutput_program>
  <BlastOutput_version>BLASTP 2.6.0+</BlastOutput_version>
  <BlastOutput_reference>Stephen F. Altschul, Thomas L. Madden, Alejandro A. Sch&amp;auml;ffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), &quot;Gapped BLAST and PSI-BLAST: a new generation of protein database search program...
  <BlastOutput_db>database</BlastOutput_db>
  <BlastOutput_query-ID>Query_1</BlastOutput_query-ID>
  <BlastOutput_query-def>Sulfurimonas_autotrophica_563040@ADN08900</BlastOutput_query-def>
  <BlastOutput_query-len>675</BlastOutput_query-len>
  <BlastOutput_param>
    <Parameters>
      <Parameters_matrix>BLOSUM62</Parameters_matrix>
      <Parameters_expect>10</Parameters_expect>
      <Parameters_gap-open>11</Parameters_gap-open>
      <Parameters_gap-extend>1</Parameters_gap-extend>
      <Parameters_filter>F</Parameters_filter>
    </Parameters>
  </BlastOutput_param>
<BlastOutput_iterations>
<Iteration>
  <Iteration_iter-num>1</Iteration_iter-num>
  <Iteration_query-ID>Query_1</Iteration_query-ID>
  <Iteration_query-def>Sulfurimonas_autotrophica_563040@ADN08900</Iteration_query-def>
  <Iteration_query-len>675</Iteration_query-len>
<Iteration_hits>
<Hit>
  <Hit_num>1</Hit_num>
  <Hit_id>Sulfurimonas_autotrophica_563040@ADN08900</Hit_id>
  <Hit_def>No definition line</Hit_def>
  <Hit_accession>Sulfurimonas_autotrophica_563040@ADN08900</Hit_accession>
  <Hit_len>675</Hit_len>
  <Hit_hsps>
    <Hsp>
      <Hsp_num>1</Hsp_num>
      <Hsp_bit-score>1355.89</Hsp_bit-score>
      <Hsp_score>3508</Hsp_score>
      <Hsp_evalue>0</Hsp_evalue>
      <Hsp_query-from>1</Hsp_query-from>
      <Hsp_query-to>675</Hsp_query-to>
      <Hsp_hit-from>1</Hsp_hit-from>
      <Hsp_hit-to>675</Hsp_hit-to>
      <Hsp_query-frame>0</Hsp_query-frame>
      <Hsp_hit-frame>0</Hsp_hit-frame>
      <Hsp_identity>675</Hsp_identity>
      <Hsp_positive>675</Hsp_positive>
      <Hsp_gaps>0</Hsp_gaps>
      <Hsp_align-len>675</Hsp_align-len>
      <Hsp_qseq>MSDILNHSILPFVEHFQHYAVWVVFFAAFSETLIGLGFLLPGSTFLLLLGVLAGQGYFDITSLLLFAVAGAYLGDITNYHIGKHYGTALLGKTWMPFSNEQLSRAHKFLNTHGAKSVFLARFLPGLKESVPFLAGSVKMKQSKFLFWDFFGTIGWSFEVIGIGYLFSASLVLAQIWLGRTITVLAILIFLLALLYLLKQFVVSNAHSAKIVLLSLCHSFLRNPFVSGIIKAHPK...
      <Hsp_hseq>MSDILNHSILPFVEHFQHYAVWVVFFAAFSETLIGLGFLLPGSTFLLLLGVLAGQGYFDITSLLLFAVAGAYLGDITNYHIGKHYGTALLGKTWMPFSNEQLSRAHKFLNTHGAKSVFLARFLPGLKESVPFLAGSVKMKQSKFLFWDFFGTIGWSFEVIGIGYLFSASLVLAQIWLGRTITVLAILIFLLALLYLLKQFVVSNAHSAKIVLLSLCHSFLRNPFVSGIIKAHPK...
      <Hsp_midline>MSDILNHSILPFVEHFQHYAVWVVFFAAFSETLIGLGFLLPGSTFLLLLGVLAGQGYFDITSLLLFAVAGAYLGDITNYHIGKHYGTALLGKTWMPFSNEQLSRAHKFLNTHGAKSVFLARFLPGLKESVPFLAGSVKMKQSKFLFWDFFGTIGWSFEVIGIGYLFSASLVLAQIWLGRTITVLAILIFLLALLYLLKQFVVSNAHSAKIVLLSLCHSFLRNPFVSGIIKA...
    </Hsp>
  </Hit_hsps>
</Hit>
<Hit>
  <Hit_num>2</Hit_num>
  <Hit_id>Hippea_maritima_760142@AEA33167</Hit_id>
  <Hit_def>No definition line</Hit_def>
  <Hit_accession>Hippea_maritima_760142@AEA33167</Hit_accession>
  <Hit_len>698</Hit_len>
  <Hit_hsps>
    <Hsp>
      <Hsp_num>1</Hsp_num>
      <Hsp_bit-score>366.311</Hsp_bit-score>
      <Hsp_score>939</Hsp_score>
      <Hsp_evalue>1.64684e-119</Hsp_evalue>
      <Hsp_query-from>1</Hsp_query-from>
      <Hsp_query-to>674</Hsp_query-to>
      <Hsp_hit-from>3</Hsp_hit-from>
      <Hsp_hit-to>698</Hsp_hit-to>
      <Hsp_query-frame>0</Hsp_query-frame>
      <Hsp_hit-frame>0</Hsp_hit-frame>
      <Hsp_identity>237</Hsp_identity>
      <Hsp_positive>368</Hsp_positive>
      <Hsp_gaps>48</Hsp_gaps>
      <Hsp_align-len>709</Hsp_align-len>
      <Hsp_qseq>MSDILNHSILPFVEHFQHYAVWVVFFAAFSETLIGLGFLLPGSTFLLLLGVLAGQGYFDITSLLLFAVAGAYLGDITNYHIGKHYGTALLGKTWMPFSNEQLSRAHKFLNTHGAKSVFLARFLPGLKESVPFLAGSVKMKQSKFLFWDFFGTIGWSFEVIGIGYLFSASLVLAQIWLGRTITVLAILIFLLALLYLLKQFVVSNAHSAKIVLLSLCHSFLRNPFVSGIIKAHPK...
      <Hsp_hseq>LTEIFNNYIVPYVVHLGILGYWIAALATLLETILVIGLFIPGSTIVLIFGALSAAGYYNFLYLMAFTVSSAVLGDYINYKLGKKYGKSWIVKEKWFLKKSHLEKGKRFFDSYGARSLSIGRLIPGLKETFPFIAGSMDTKLTKFLFWDVIGAIAWSFEFLSAGYLFGSSINLAKAWLGRITIVIAIIFFIFAVLYAFKFFFVKYGSYILALQKSIWNYLKTNSDILRLIDKYPK...
      <Hsp_midline>+++I N+ I+P+V H      W+   A   ET++ +G  +PGST +L+ G L+  GY++   L+ F V+ A LGD  NY +GK YG + + K         L +  +F +++GA+S+ + R +PGLKE+ PF+AGS+  K +KFLFWD  G I WSFE +  GYLF +S+ LA+ WLGR   V+AI+ F+ A+LY  K F V        +  S+ +    N  +  +I  ...
    </Hsp>

test/blastp.out view on Meta::CPAN

      <Hsp_bit-score>26.1794</Hsp_bit-score>
      <Hsp_score>56</Hsp_score>
      <Hsp_evalue>0.349341</Hsp_evalue>
      <Hsp_query-from>353</Hsp_query-from>
      <Hsp_query-to>435</Hsp_query-to>
      <Hsp_hit-from>110</Hsp_hit-from>
      <Hsp_hit-to>193</Hsp_hit-to>
      <Hsp_query-frame>0</Hsp_query-frame>
      <Hsp_hit-frame>0</Hsp_hit-frame>
      <Hsp_identity>21</Hsp_identity>
      <Hsp_positive>39</Hsp_positive>
      <Hsp_gaps>3</Hsp_gaps>
      <Hsp_align-len>85</Hsp_align-len>
      <Hsp_qseq>LFQRQRPFN-MTHLMEFSFPSGHTAYSAFFYGFLAYA-LARGTTDRGKKVDLFFLWVLLVTAVGFSRLYIGVHYLSDVLAGALLG</Hsp_qseq>
      <Hsp_hseq>LVKRPHPFGALIHTARYSFPSV-SVFSIMILVFLIWHFIVPNFSYLFSRITIRFLLVFWIIVISLIKIYLCAVFPSDILASISLS</Hsp_hseq>
      <Hsp_midline>L +R  PF  + H   +SFPS  + +S     FL +  +    +    ++ + FL V  +  +   ++Y+   + SD+LA   L </Hsp_midline>
    </Hsp>
  </Hit_hsps>
</Hit>
<Hit>
  <Hit_num>240</Hit_num>
  <Hit_id>Helicobacter_pylori_85963@AAD05898</Hit_id>
  <Hit_def>No definition line</Hit_def>
  <Hit_accession>Helicobacter_pylori_85963@AAD05898</Hit_accession>
  <Hit_len>220</Hit_len>
  <Hit_hsps>
    <Hsp>
      <Hsp_num>1</Hsp_num>
      <Hsp_bit-score>21.9422</Hsp_bit-score>
      <Hsp_score>45</Hsp_score>
      <Hsp_evalue>6.88145</Hsp_evalue>
      <Hsp_query-from>261</Hsp_query-from>
      <Hsp_query-to>450</Hsp_query-to>
      <Hsp_hit-from>23</Hsp_hit-from>
      <Hsp_hit-to>219</Hsp_hit-to>
      <Hsp_query-frame>0</Hsp_query-frame>
      <Hsp_hit-frame>0</Hsp_hit-frame>
      <Hsp_identity>55</Hsp_identity>
      <Hsp_positive>89</Hsp_positive>
      <Hsp_gaps>23</Hsp_gaps>
      <Hsp_align-len>205</Hsp_align-len>
      <Hsp_qseq>SLVLLGGV-------VEDLLTADPIVAVDKRLATLLLAFRS-PILLWIFLKVTLLGSWQIVLGGVILFSLYLLLDNKKYFLAPFWVTLGGCTFFTTGGKWLFQRQRPFNMTHLMEF-----SFPSGHTAYSAFFYGFLAYALARGTTDRGKKVDLFFLWVLLVTAVGFSRLYIGVHYLSDVLAGALLGF--SWLIIGISLSEWRK</Hsp_qseq>
      <Hsp_hseq>TLFLLGGVFSAFFILIAGLVFFDYANSMDNAIFNLMRSNSSNPILDQTLQRIVFLGSSQFVLPLSLLVGVFLSLYRKNLALG-VWFVLSVVIF-----EALLESLKHL-LAHSIQWLSHSANFPSTIALSLALFYGLLILLIPHFIAHQIFQNILSYSLFGLILLIGLALIVLGVSF-SSVLGGVCLGALGACFSIGIYLSVFQK</Hsp_hseq>
      <Hsp_midline>+L LLGGV       +  L+  D   ++D  +  L+ +  S PIL     ++  LGS Q VL   +L  ++L L  K   L   W  L    F     + L +  +   + H +++     +FPS      A FYG L   +      +  +  L +    L+  +G + + +GV + S VL G  LG   +   IGI LS ++K</Hsp_midline>
    </Hsp>
  </Hit_hsps>
</Hit>
</Iteration_hits>
  <Iteration_stat>
    <Statistics>
      <Statistics_db-num>242</Statistics_db-num>
      <Statistics_db-len>58121</Statistics_db-len>
      <Statistics_hsp-len>68</Statistics_hsp-len>
      <Statistics_eff-space>26498940</Statistics_eff-space>
      <Statistics_kappa>0.041</Statistics_kappa>
      <Statistics_lambda>0.267</Statistics_lambda>
      <Statistics_entropy>0.14</Statistics_entropy>
    </Statistics>
  </Iteration_stat>
</Iteration>
</BlastOutput_iterations>
</BlastOutput>

( run in 0.749 second using v1.01-cache-2.11-cpan-96521ef73a4 )