BioPerl-Run
view release on metacpan or search on metacpan
# testing in-memory use of
my $in = Bio::SeqIO->new(
-format => 'fasta',
-file => test_input_file('cysprot1a.fa')
);
my $seq = $in->next_seq();
my @amino;
$in = Bio::SeqIO->new(
-format => 'fasta',
-file => test_input_file('amino.fa')
);
while ( my $s = $in->next_seq ) {
push @amino, $s;
}
my %expected;
if ( $version ge '2.8.0' ) {
$water->run(
{ -asequence => $seq,
-bsequence => \@amino,
-gapopen => '10.0',
-gapextend => '0.5',
-outfile => $wateroutfile
}
);
%expected = (
'alnlen' => 394,
'opid' => '30.71',
'apid' => '40.20'
);
} else {
$water->run(
{ -sequencea => $seq,
-seqall => \@amino,
-gapopen => '10.0',
-gapextend => '0.5',
-outfile => $wateroutfile
}
);
%expected = (
'alnlen' => 339,
'opid' => '33.04',
'apid' => '40.58'
);
}
ok( -e $wateroutfile );
my $alnin = Bio::AlignIO->new(
-format => 'emboss',
-file => $wateroutfile
);
ok($alnin);
my $aln = $alnin->next_aln;
ok($aln);
is( $aln->length, 43 );
is( $aln->overall_percentage_identity, 100 );
is( $aln->average_percentage_identity, 100 );
my ($first) = $aln->each_seq();
ok( $first->seq(), 'SCWSFSTTGNVEGQHFISQNKLVSLSEQNLVDCDHECMEYEGE' );
$aln = $alnin->next_aln;
ok($aln);
is( $aln->length, $expected{'alnlen'} );
is( sprintf( "%.2f", $aln->overall_percentage_identity ),
$expected{'opid'} );
is( sprintf( "%.2f", $aln->average_percentage_identity ),
$expected{'apid'} );
my $cons = $factory->program('cons');
$cons->verbose(0);
$in = Bio::AlignIO->new(
-format => 'msf',
-file => test_input_file('cysprot.msf')
);
my $aln2 = $in->next_aln;
if ( $version ge '2.8.0' ) {
$cons->run(
{ -sequence => $aln2,
-outseq => $consoutfile
}
);
} else {
$cons->run(
{ -msf => $aln2,
-outseq => $consoutfile
}
);
}
ok( -e $consoutfile );
# testing acd parsing and EMBOSSacd methods
$compseqapp = $factory->program('compseq');
ok my $acd = $compseqapp->acd;
is $compseqapp->acd->name, 'compseq';
ok my $compseq_mand_acd = $compseqapp->acd->mandatory;
ok $compseq_mand_acd->mandatory->qualifier('-word');
is $compseq_mand_acd->mandatory->qualifier('-supper1'), 0;
is $acd->qualifier('-ppppppp'), 0;
ok $acd->qualifier('-reverse');
is $acd->category('-reverse'), 'optional';
like $acd->values('-reverse'), qr/(?:Yes\/No|true)/;
like $acd->descr('-reverse'), qr/(?:boolean|true)/;
is $acd->unnamed('-reverse'), 0;
like $acd->default('-reverse'), qr/(?:Yes\/No|true)/;
}
__END__
## comparing input and ACD qualifiers
## commented out because verbose > 1 prints error messages
## that would confuse users running tests
$compseqapp->verbose(1);
%input = ( '-word' => 4,
'-outfile' => $compseqoutfile);
eval {
my $a = $compseqapp->run(\%input);
};
ok 1 if $@; # '-sequence' missing
%input = ( '-word' => 4,
'-incorrect_option' => 'no value',
'-sequence' => test_input_file('dna1.fa'),
'-outfile' => $compseqoutfile);
( run in 0.588 second using v1.01-cache-2.11-cpan-7fcb06a456a )