view release on metacpan or  search on metacpan

t/EMBOSS.t  view on Meta::CPAN

    # testing in-memory use of
    my $in = Bio::SeqIO->new(
        -format => 'fasta',
        -file   => test_input_file('cysprot1a.fa')
    );
    my $seq = $in->next_seq();

    my @amino;
    $in = Bio::SeqIO->new(
        -format => 'fasta',
        -file   => test_input_file('amino.fa')
    );
    while ( my $s = $in->next_seq ) {
        push @amino, $s;
    }

    my %expected;
    if ( $version ge '2.8.0' ) {
        $water->run(
            {   -asequence => $seq,
                -bsequence => \@amino,
                -gapopen   => '10.0',
                -gapextend => '0.5',
                -outfile   => $wateroutfile
            }
        );
        %expected = (
            'alnlen' => 394,
            'opid'   => '30.71',
            'apid'   => '40.20'
        );

    } else {
        $water->run(
            {   -sequencea => $seq,
                -seqall    => \@amino,
                -gapopen   => '10.0',
                -gapextend => '0.5',
                -outfile   => $wateroutfile
            }
        );
        %expected = (
            'alnlen' => 339,
            'opid'   => '33.04',
            'apid'   => '40.58'
        );

    }
    ok( -e $wateroutfile );

    my $alnin = Bio::AlignIO->new(
        -format => 'emboss',
        -file   => $wateroutfile
    );

    ok($alnin);
    my $aln = $alnin->next_aln;
    ok($aln);
    is( $aln->length,                      43 );
    is( $aln->overall_percentage_identity, 100 );
    is( $aln->average_percentage_identity, 100 );

    my ($first) = $aln->each_seq();
    ok( $first->seq(), 'SCWSFSTTGNVEGQHFISQNKLVSLSEQNLVDCDHECMEYEGE' );
    $aln = $alnin->next_aln;
    ok($aln);

    is( $aln->length, $expected{'alnlen'} );
    is( sprintf( "%.2f", $aln->overall_percentage_identity ),
        $expected{'opid'} );
    is( sprintf( "%.2f", $aln->average_percentage_identity ),
        $expected{'apid'} );

    my $cons = $factory->program('cons');
    $cons->verbose(0);
    $in = Bio::AlignIO->new(
        -format => 'msf',
        -file   => test_input_file('cysprot.msf')
    );
    my $aln2 = $in->next_aln;
    if ( $version ge '2.8.0' ) {
        $cons->run(
            {   -sequence => $aln2,
                -outseq   => $consoutfile
            }
        );
    } else {
        $cons->run(
            {   -msf    => $aln2,
                -outseq => $consoutfile
            }
        );
    }
    ok( -e $consoutfile );

    # testing acd parsing and EMBOSSacd methods

    $compseqapp = $factory->program('compseq');

    ok my $acd = $compseqapp->acd;
    is $compseqapp->acd->name, 'compseq';
    ok my $compseq_mand_acd = $compseqapp->acd->mandatory;
    ok $compseq_mand_acd->mandatory->qualifier('-word');
    is $compseq_mand_acd->mandatory->qualifier('-supper1'), 0;
    is $acd->qualifier('-ppppppp'), 0;
    ok $acd->qualifier('-reverse');
    is $acd->category('-reverse'),  'optional';
    like $acd->values('-reverse'),  qr/(?:Yes\/No|true)/;
    like $acd->descr('-reverse'),   qr/(?:boolean|true)/;
    is $acd->unnamed('-reverse'),   0;
    like $acd->default('-reverse'), qr/(?:Yes\/No|true)/;
}

__END__

## comparing input and ACD qualifiers
## commented out because verbose > 1 prints error messages
## that would confuse users running tests

$compseqapp->verbose(1);
%input = ( '-word' => 4,
       '-outfile' => $compseqoutfile);
eval {
    my $a = $compseqapp->run(\%input);
};
ok 1 if $@; # '-sequence' missing

 %input = ( '-word' => 4,
       '-incorrect_option' => 'no value',
       '-sequence' => test_input_file('dna1.fa'),
       '-outfile' => $compseqoutfile);